PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_1741_f_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 196aa    MW: 21421.8 Da    PI: 7.9816
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_1741_f_2genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF57.51.8e-181357246
                   ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEE CS
         SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkl 46
                    i+ +  rqv+  kRr g++KKA+EL++LC++e a++ifs++gk+
  Neem_1741_f_2 13 MIQGNEARQVSCPKRRSGLFKKASELCTLCAVETALVIFSPSGKV 57
                   6777889************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.8E-21463IPR002100Transcription factor, MADS-box
PROSITE profilePS5006619.61464IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.31E-20472IPR002100Transcription factor, MADS-box
CDDcd001204.40E-20557No hitNo description
PRINTSPR004042.6E-12626IPR002100Transcription factor, MADS-box
PfamPF003192.1E-181457IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-122641IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-124162IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MTRMGHKKAQ MKMIQGNEAR QVSCPKRRSG LFKKASELCT LCAVETALVI FSPSGKVLPP  60
GHPAVETIMK QLALAGKPDS GLTQLAETEH EATLRALNKE YHDLLEQLEA EKKRGEKLAQ  120
LKMETQCQGK TLIDTPVDEL NLTELLTLKV MLEEFQGKLI KHMKERAAKS SAANSAEAID  180
PFATDPAEGS SVNPGN
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006466398.13e-65PREDICTED: agamous-like MADS-box protein AGL61
RefseqXP_006466399.13e-65PREDICTED: agamous-like MADS-box protein AGL61
RefseqXP_006466400.13e-65PREDICTED: agamous-like MADS-box protein AGL61
TrEMBLB9T1681e-60B9T168_RICCO; Mads box protein, putative
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2282244
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.14e-29AGAMOUS-like 62